PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009102279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 232aa    MW: 26136.2 Da    PI: 8.5686
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009102279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702180.29.3e-56632042154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                     rs t+sCqdCGnqakk+C+h+RCRtCCks+g+dC thv+stW+paakrrerqqq ++++ +++ +                +    s  l+ +  
  XP_009102279.1  63 RSVTISCQDCGNQAKKGCTHMRCRTCCKSQGLDCPTHVRSTWIPAAKRRERQQQIETPTGNRNGRG-CGV----------GNIPKRSWDLPDTLD 146
                     67899*************************************************999866554422.222..........222233445555666 PP

          DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     + e++ + +Peevss+a frcvr+s+ ddge ++aYqt+v i+GhvfkGiLy qG+e+
  XP_009102279.1 147 SPEMDGTAFPEEVSSDAHFRCVRMSGTDDGESQFAYQTTVGIAGHVFKGILYSQGPES 204
                     66899999************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.5E-5666203IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.4E-2768110IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.3E-27154202IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MAGIGSSRNN EEDNQHKTNW LWYRNTVSSN TSHNNQQQIW QQQSLDLYPG QINVCDVTTS  60
SSRSVTISCQ DCGNQAKKGC THMRCRTCCK SQGLDCPTHV RSTWIPAAKR RERQQQIETP  120
TGNRNGRGCG VGNIPKRSWD LPDTLDSPEM DGTAFPEEVS SDAHFRCVRM SGTDDGESQF  180
AYQTTVGIAG HVFKGILYSQ GPESMMMPGG RTGKARMERM RWKWKWPLEG RI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102279.11e-175PREDICTED: protein SHI RELATED SEQUENCE 4 isoform X1
SwissprotQ9SI191e-101SRS4_ARATH; Protein SHI RELATED SEQUENCE 4
TrEMBLA0A078I6131e-157A0A078I613_BRANA; BnaA07g01860D protein
TrEMBLM4FFP31e-157M4FFP3_BRARP; Uncharacterized protein
STRINGBra039917.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151171519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18120.12e-83SHI-related sequence 4